Protein Info for Dsui_1516 in Dechlorosoma suillum PS

Annotation: HAD-superfamily subfamily IB hydrolase, TIGR01490

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 3 to 193 (191 residues), 70.3 bits, see alignment E=2e-23 TIGR01490: HAD hydrolase, family IB" amino acids 3 to 203 (201 residues), 142 bits, see alignment E=3e-45 PF12710: HAD" amino acids 4 to 191 (188 residues), 120.7 bits, see alignment E=5.3e-39

Best Hits

KEGG orthology group: None (inferred from 70% identity to nmu:Nmul_A2615)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP52 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Dsui_1516 HAD-superfamily subfamily IB hydrolase, TIGR01490 (Dechlorosoma suillum PS)
MNLALFDLDNTLLAGDSDFEWAQFLIGQGALDGEIHAAQNEKFYEQYKAGTLDIYEFLDF
QLKPLARHSRAQLDAWHQEFMARNIRPIMTDQARAKVQEHLQRGDLVLLVTATNAFVTGP
IAREFGIHHLIATIPEQRDGQFTGGVRGTPSFQDGKITRVEDWLEAQGLNWGSFADSWFY
SDSRNDLPLLEKVSCPVAVDPDPILKAEAERRGWPVISLR