Protein Info for Dsui_1504 in Dechlorosoma suillum PS

Annotation: trypsin-like serine protease with C-terminal PDZ domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details PF13365: Trypsin_2" amino acids 102 to 241 (140 residues), 124.6 bits, see alignment E=1.1e-39 PF00089: Trypsin" amino acids 103 to 267 (165 residues), 59.1 bits, see alignment E=1.2e-19 PF13180: PDZ_2" amino acids 280 to 379 (100 residues), 38.8 bits, see alignment E=1.8e-13 PF00595: PDZ" amino acids 281 to 366 (86 residues), 25.1 bits, see alignment E=3.7e-09

Best Hits

Swiss-Prot: 46% identical to DEGP1_ARATH: Protease Do-like 1, chloroplastic (DEGP1) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 98% identity to bmj:BMULJ_00932)

Predicted SEED Role

"Peptidase S1, chymotrypsin:PDZ/DHR/GLGF domain precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP42 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Dsui_1504 trypsin-like serine protease with C-terminal PDZ domain (Dechlorosoma suillum PS)
MAYPNPYPRPAPDTFIRRWLFITACIAALMLLWQFLPAIEAWFSPREAAERTVTARGDLA
ADEKATIELFEKSRASVVYITTAQLVRDVWTRNVFSVPRGTGSGFIWDDAGHVVTNFHVI
QGASEATVKLADGRDYQAALVGASPAHDIAVLKIGVGFKRPPAVPVGTSTDLKVGQKVFA
IGNPFGLDWTLTTGIVSALDRSLPGEAGGPAIDHLVQTDAAINPGNSGGPLLDSAGRLIG
INTAIYSPSGASAGIGFAVPVDTVMQVVPQLIKTGKYIRPALGIEVDEQLNQRLLALTGS
KGVFVLRVTPGSAAHKAGLAGVEVTPQGIVPGDRIIDVDGKATDDVAKLLARLDDRKVGD
VVVLSVERAGKSREVRVELQPGI