Protein Info for Dsui_1498 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details PF03729: DUF308" amino acids 30 to 101 (72 residues), 52.6 bits, see alignment E=2.3e-18 amino acids 88 to 161 (74 residues), 34.9 bits, see alignment E=7.6e-13 amino acids 164 to 201 (38 residues), 18 bits, see alignment 1.4e-07

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpf:Rpic12D_0620)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP36 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Dsui_1498 hypothetical protein (Dechlorosoma suillum PS)
MNTDTITDSSADEPTKTLCSLTENWWIFALRGVLALIFAALAFWMPQSALLAMTLVFGAF
SLVNGAFNLVAAVRHIQKKERWGWLLFSGIVGILTGVVVLVAPWVATMVMASFLWASVGF
WAIFTGVLEISAAVRLRQEIKGEIWLAFSGLLSIVLGAIVLWIFFSRPVESFLAAGWLLG
FYAAVYGVTLLFLSWRLRKTRQG