Protein Info for Dsui_1471 in Dechlorosoma suillum PS

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF02548: Pantoate_transf" amino acids 9 to 265 (257 residues), 368.9 bits, see alignment E=6.9e-115 TIGR00222: 3-methyl-2-oxobutanoate hydroxymethyltransferase" amino acids 12 to 270 (259 residues), 334.8 bits, see alignment E=2e-104

Best Hits

Swiss-Prot: 68% identical to PANB_DECAR: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 73% identity to app:CAP2UW1_2452)

MetaCyc: 51% identical to 3-methyl-2-oxobutanoate hydroxymethyltransferase (Escherichia coli K-12 substr. MG1655)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNM1 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Dsui_1471 3-methyl-2-oxobutanoate hydroxymethyltransferase (Dechlorosoma suillum PS)
MSSQSTTRRLTITDMAKLKAAGEKIAMLTCYDASFARLCDNAGVDTVLVGDSLGMVVQGH
DSTLPVTLADMVYHTAMVARGCDRPLIITDMPFGTYQETPELAFRNAVQLMAAGAQMVKI
EGGEDMAETVRFLTHRGIPVCGHIGLTPQSVHQLGGYRVQGKDEAGAAQLKADALAIQAA
GASMVVLEAIPRALAAEVTALLQIPTIGIGASVECSGQVLVLQDMLDIAPGRKARFVRNF
MTGQPSVAAAIAAYVAAVKDCTFPAAEHCY