Protein Info for Dsui_1448 in Dechlorosoma suillum PS

Annotation: putative ornithine cyclodeaminase, mu-crystallin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 52 to 70 (19 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details PF02423: OCD_Mu_crystall" amino acids 6 to 311 (306 residues), 189.8 bits, see alignment E=3.1e-60

Best Hits

KEGG orthology group: K01750, ornithine cyclodeaminase [EC: 4.3.1.12] (inferred from 71% identity to dar:Daro_3361)

Predicted SEED Role

"Ornithine cyclodeaminase (EC 4.3.1.12)" in subsystem Arginine and Ornithine Degradation (EC 4.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNJ8 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Dsui_1448 putative ornithine cyclodeaminase, mu-crystallin (Dechlorosoma suillum PS)
MALYLSEADVQSVLTMPMALEAVETAHRELSREGALAAQDTPRARTRLPQTALHLLHGGL
PGLGILGYKAYTSNRSGNRFNVFLFDAASGVLQAVVAADYLGMMRTGAASGIAAKWLARP
DSEVAGVFGSGWQARGHVEAICTALPLRRVKVYGRKRDKLEAFCAEMGQRLPGVEIVPAA
DAEATVRGADVIGTITTAAAPLFDADWLVPGVHINAAGSNALIRQELSEAAVRRCDLVAV
DTVDTALKEAGDLVPLLEKGRLSARQLVELGDVIVGRRAGRSSPEQITLFESQGLAVQDL
VLASLVLAQARARGLGLELPFGG