Protein Info for Dsui_1436 in Dechlorosoma suillum PS

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 191 to 209 (19 residues), see Phobius details PF02203: TarH" amino acids 1 to 171 (171 residues), 54.7 bits, see alignment E=2.4e-18 PF12729: 4HB_MCP_1" amino acids 4 to 182 (179 residues), 90.3 bits, see alignment E=2.3e-29 PF00672: HAMP" amino acids 208 to 259 (52 residues), 47.4 bits, see alignment 3.8e-16 PF00015: MCPsignal" amino acids 323 to 482 (160 residues), 124.2 bits, see alignment E=1.1e-39

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 58% identity to gca:Galf_1972)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNI6 at UniProt or InterPro

Protein Sequence (540 amino acids)

>Dsui_1436 methyl-accepting chemotaxis protein (Dechlorosoma suillum PS)
MIANLRIGTRLGIAFAILVLLLTGVAVLSVTKANAINDELNVIVKDRFPKVVKANVIIDI
LNANARVVRNMLLLTKADDIKREADRLPDMSKRMSEELDAISKMPMNDEEKAVLAEINAA
RGPYRDHLVKVIKLANDGAREEGTALLLGDMRKSFNDYIKTLEKLIELETKSMEATGKSA
DELVVATRNQIITVGIIAGLLAIVLGVFITRSITTPLNQAVGVANKLSEGDLTVRIDASS
KDETGQLLAAMQAMVAKLAQIIGEVRGAADNLSSASEQVSATAQSLSQSSSEQAASVEEI
TSTLEESTASINQNTENAKVTDNMAAKAANEANEGGTAVKDTVVAMKQIAGKIGIIDDIA
YQTNLLALNAAIEAARAGEHGKGFAVVAAEVRKLAERSQVAAQEIGELADSSVKLAEKAG
GLLDNMVPTIRKTSDLVQEIASASAEQSGGIAQINQAMNQLNQATQQNASASEELAATAE
EMGGQAEQLQGLMQFFRVEEGRSAVAYSARPAQTARSAVKSQPVRPVATAAPDEHDFERF