Protein Info for Dsui_1421 in Dechlorosoma suillum PS

Annotation: HIT family hydrolase, diadenosine tetraphosphate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 PF11969: DcpS_C" amino acids 3 to 107 (105 residues), 89.5 bits, see alignment E=2.1e-29 PF01230: HIT" amino acids 11 to 106 (96 residues), 92.5 bits, see alignment E=2.1e-30

Best Hits

Swiss-Prot: 53% identical to HITA_NEIGO: Protein HitA (hitA) from Neisseria gonorrhoeae

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 76% identity to app:CAP2UW1_4041)

MetaCyc: 48% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNH1 at UniProt or InterPro

Protein Sequence (119 amino acids)

>Dsui_1421 HIT family hydrolase, diadenosine tetraphosphate hydrolase (Dechlorosoma suillum PS)
MDNCIFCKIVRGEIPSRKVYEDEHVFAFHDINPLRPVHVLVIPKRHIESLAHASEADAPV
LGRLLAVANKIAVDQGSPEGFRVIINTGRIGQQEVPHLHAHIVGGDAPVGPMLKRIQGD