Protein Info for Dsui_1415 in Dechlorosoma suillum PS

Annotation: imidazoleglycerol-phosphate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF00475: IGPD" amino acids 32 to 174 (143 residues), 221.1 bits, see alignment E=2.9e-70

Best Hits

Swiss-Prot: 80% identical to HIS7_DECAR: Imidazoleglycerol-phosphate dehydratase (hisB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01693, imidazoleglycerol-phosphate dehydratase [EC: 4.2.1.19] (inferred from 80% identity to dar:Daro_3382)

Predicted SEED Role

"Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19)" in subsystem Histidine Biosynthesis (EC 4.2.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNG5 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Dsui_1415 imidazoleglycerol-phosphate dehydratase (Dechlorosoma suillum PS)
MRQAEVSRNTLETQITVRLNLDGTGCAKLNSGIPFLDHMLDQIARHGLIDLEVEAKGDLH
IDGHHTVEDIGIAIGQALTQALGDKKGLTRYGHAYVPLDEALSRVVVDLSGRPGLEFHVD
FKRAMLGTLDTELVHEFFQGLVNHAFITLHVDNLRGENAHHQCETVFKAFARALRMAVSP
DPRTAGVIPSTKGAL