Protein Info for Dsui_1397 in Dechlorosoma suillum PS

Annotation: response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 PF00072: Response_reg" amino acids 17 to 131 (115 residues), 48.8 bits, see alignment E=2.2e-16 PF14532: Sigma54_activ_2" amino acids 148 to 318 (171 residues), 66.3 bits, see alignment E=1.1e-21 PF00158: Sigma54_activat" amino acids 148 to 313 (166 residues), 218.5 bits, see alignment E=1.4e-68 PF07728: AAA_5" amino acids 170 to 291 (122 residues), 26.7 bits, see alignment E=1.5e-09 PF25601: AAA_lid_14" amino acids 319 to 399 (81 residues), 51.9 bits, see alignment E=1.7e-17 PF02954: HTH_8" amino acids 432 to 468 (37 residues), 41.6 bits, see alignment 2.5e-14

Best Hits

KEGG orthology group: None (inferred from 63% identity to mfa:Mfla_0074)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN07 at UniProt or InterPro

Protein Sequence (487 amino acids)

>Dsui_1397 response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Dechlorosoma suillum PS)
MPDKSAFPAASSRPLLLIVDDDPLISDTLAYSLASSFEVLTSPSRSHCASLLRQLRQPPD
LALVDLGLPPLPHQPDEGFALIGELLALSPAMRILVLSGQDGEAHGRHARTLGAVDFIAK
PADPALLRQALLNSLTFREAAPADSPLLGHSEPMEKLRAQIHHYADSPFPVLIEGESGSG
KEIVAHQLHLATGRRDKPYLALNCAAISPTLLEPTLFGHAKGAFTGAAGARSGYFEDAAD
GTLFLDEIGELPLELQPKLLRVLENGEFQRVGETQSRRSNARIVAATNRDLKREVREGRF
RADLYHRLSVFSILVPPLREMGRDRQELLEHFRQRYAQQSHLPPFQLDEPARALWDGYAF
PGNVRELRNIVIRLTAKYPGQTVTAEQLAGELDLPQPDTGPRHDQPVTPDIRAAREHLQQ
APAGFDLDQHLARWEKAYVEAALQITQGNLSQAARLLGINRTTLHARRDSLERLPSQDQG
NEDRHVP