Protein Info for Dsui_1395 in Dechlorosoma suillum PS

Annotation: MSHA-type pilus biogenesis protein MshL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR02519: pilus (MSHA type) biogenesis protein MshL" amino acids 306 to 593 (288 residues), 258.2 bits, see alignment E=3.8e-81 PF00263: Secretin" amino acids 410 to 594 (185 residues), 126.9 bits, see alignment E=6.3e-41

Best Hits

Predicted SEED Role

"Type II secretion pathway protein D homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN05 at UniProt or InterPro

Protein Sequence (634 amino acids)

>Dsui_1395 MSHA-type pilus biogenesis protein MshL (Dechlorosoma suillum PS)
MKPAHYGPRPDGLPSLPKHFPVRALLAALSLGLLGACASPVAKDPSKAHLQADSAPVVSG
AIPAPVMQTAALPKPRIAPRTETYSVVVNNVKVQELLFALARDAKLNVDIHPGISGTVTL
NAIDQTLPQILNRLAKQVDMRFELDGPNLAVMPDTPYLRNYKIDYVNMTRDTAGTVSVTT
QIATAGAGASTTGTTTVPGTAGSGNSSVTRIENKAQHHFWDNLIQNIKDILRETDKVMPE
GSSETVTEVAATQTTTGTGTPPAAGSRTSAPATSLAGSANPATLQNSGAMVVRRTTFREA
ASVMAHPETGIVTVRATSRQHEKIQEYVDQVMGSARRQVLIEATIAEVRLDQNYQQGINW
SRITGGAAGFTLTQTLGGAVAGIIASGSNFEIGYKNSTSGGGFTSALRLLETFGTVKVLS
SPKISVLNNQTAVIKVVDNHVYFTIKADTSQNQVNTVTTYTTTLNSVPVGFVMNVTAQIS
GDDTVLLNIRPSISRVVDEIPDPNPALKKGINGLADSIESKVPVIRTREMESVLRVENGN
IAVMGGLMEEMLQNRADSVPGLSRLPVAGGLFSAKDDSLQKTELVIFLRPVIIREASIGG
DYANLRDALPTKDFFANNPGPQQQMAPSGMEPRP