Protein Info for Dsui_1372 in Dechlorosoma suillum PS

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 187 to 207 (21 residues), see Phobius details PF08269: dCache_2" amino acids 34 to 181 (148 residues), 118.6 bits, see alignment E=6.2e-38 PF17200: sCache_2" amino acids 39 to 187 (149 residues), 134.3 bits, see alignment E=6.6e-43 PF17201: Cache_3-Cache_2" amino acids 77 to 180 (104 residues), 35.4 bits, see alignment E=1.6e-12 PF00015: MCPsignal" amino acids 347 to 505 (159 residues), 135.7 bits, see alignment E=3e-43

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 42% identity to dar:Daro_3112)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMY2 at UniProt or InterPro

Protein Sequence (539 amino acids)

>Dsui_1372 methyl-accepting chemotaxis protein (Dechlorosoma suillum PS)
MFKTMSLKGRLTVSLLVTLIGLIVLGTFQALHLKQQLLADRKATLETAIDIAMTAIVDIQ
AQEAKGAMGREEAQTLAKAVIRSMRYQGKEYFYIYDSKGMGVMHPVRPEYEGKSHWDRQD
KSGAYTVRNLIKVALDKSGYTETMTAKPGSDVQVPKLQYLQHFPAWDWVVGTGLYIDDLD
TLFYQQLRLVALIIVLVVLAVGALSWARARATLGQIGGEPAEAVTAIRAVAGGDLTVSLG
NARDDSMLGELNRLVQVLRQMIGEIAQGAGQVASSAQEINSTATRVADSAATETEATQNM
AAAMEELTVSITHVSDNARDTEQHASNAAELAGVGEKSVDTTAANIATMADTMGKAAEQV
RALTDNAQEVARVAQVIKEIAGQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLAERTE
KATVEISSIVSRIQDETLTAAQVMDAALPEAEKAKEAAAETSELLHRIAAGSESARSLVR
EVADSTREQSEASTALAQQVERIAHQVEETSESMQHTAAASALEATAQALNQATARFRI