Protein Info for Dsui_1335 in Dechlorosoma suillum PS

Annotation: metalloendopeptidase-like membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details PF19425: Csd3_N2" amino acids 179 to 297 (119 residues), 33.2 bits, see alignment E=4.7e-12 PF01551: Peptidase_M23" amino acids 311 to 407 (97 residues), 112.6 bits, see alignment E=8.3e-37

Best Hits

KEGG orthology group: None (inferred from 50% identity to nit:NAL212_2810)

Predicted SEED Role

"Peptidase, M23/M37 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMF7 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Dsui_1335 metalloendopeptidase-like membrane protein (Dechlorosoma suillum PS)
MHQHPGSQHTSSLLPRHSPLYHLKKHPGAAAVFGALALFSMVAAFGLQPPSLSTTELIPR
PVVEDLALALPHPLDLGNQAYLREEKVHKGDSLANLLNRLGVNDALALDYIKQTPAAHPI
FRQLAPGKLVTASTSDTGELLLLSFPLNNRAENLLIERHGNTFRTREAPLVLQSRLEMKS
GEIRSSLYGATDDAGIPDAVANQLAEIFGADIDFHRDLRKGDRFTLIYEMYRHQGQSIRS
GRILAAELVNAGKVFRAVYFEDPKTSIKGSYYTPEGKSLRKAFLRSPLEFSRITSGFTNA
RLHPILQQWRAHKGVDYGAPTGTKVRATGDGIVEFIGRQGGYGNLIILRHQGRYSTAYGH
LSSFTPQLRKGSRVSQGEHIGNVGATGWATGPHLHYEFRIGGEQVNPLAVQLPGAPSLET
AQLLQFRQKTQDLLAQLEMLKQSDMVAFQE