Protein Info for Dsui_1305 in Dechlorosoma suillum PS

Annotation: ribosome biogenesis GTP-binding protein YsxC/EngB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR03598: ribosome biogenesis GTP-binding protein YsxC" amino acids 8 to 191 (184 residues), 230 bits, see alignment E=8.6e-73 PF01926: MMR_HSR1" amino acids 26 to 144 (119 residues), 63.6 bits, see alignment E=1.8e-21

Best Hits

Swiss-Prot: 67% identical to ENGB_DECAR: Probable GTP-binding protein EngB (engB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03978, GTP-binding protein (inferred from 74% identity to app:CAP2UW1_0302)

Predicted SEED Role

"GTP-binding protein EngB" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMC7 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Dsui_1305 ribosome biogenesis GTP-binding protein YsxC/EngB (Dechlorosoma suillum PS)
MALFQKAVFLTTVAHLRDLPEDALAEVAFAGRSNAGKSSAINTLANHTRLAFVSKTPGRT
QHLNFFKLEEGKFLVDLPGYGYAKAPEEIRSQWEGLLGPYLQHRGPLSGLVLIMDSRHPL
TELDQNLIDWFAATGKPLHIMLSKADKLTRQEQSLVLRQVKAAMADLGERCTVQLFSSLK
KTGVEEAEKVIAGWMGMEVPLPRPAPPPRPIRSAKSAAGAKQNRTHAPGNKKAVLAGGKP
AKPKPAKAPAQK