Protein Info for Dsui_1304 in Dechlorosoma suillum PS

Annotation: cytochrome c553

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 28 to 108 (81 residues), 22.2 bits, see alignment E=1.4e-08 amino acids 126 to 208 (83 residues), 31.1 bits, see alignment E=2.5e-11 PF00034: Cytochrom_C" amino acids 30 to 109 (80 residues), 37.6 bits, see alignment E=4.6e-13 amino acids 126 to 208 (83 residues), 38.9 bits, see alignment E=1.8e-13

Best Hits

Swiss-Prot: 49% identical to CYC4_THIRO: Cytochrome c4 from Thiocapsa roseopersicina

KEGG orthology group: None (inferred from 72% identity to dar:Daro_0624)

Predicted SEED Role

"Cytochrome c4" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMC6 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Dsui_1304 cytochrome c553 (Dechlorosoma suillum PS)
MIRTTALALLLAASFTAHANPEAAAKPDPAKGKPIAEAVCGACHGTDGNSLAAANPNLAG
QIPEYIVKQLSNFKPGADGKAPLRNNAIMAGMAATLATEDDMKNVAAYFAAQTLKPQVAK
DEKLVAQGQKLWRAGDVKKGIPACAGCHGAAGAGLPAQFPRLAGQWAEYTENQLKTFRSG
ERGNDPEKMMRTIAAKMSDQEIKAVAEYAAGLR