Protein Info for Dsui_1302 in Dechlorosoma suillum PS

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF04542: Sigma70_r2" amino acids 10 to 69 (60 residues), 55.1 bits, see alignment E=8e-19 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 11 to 152 (142 residues), 81.9 bits, see alignment E=2e-27 PF08281: Sigma70_r4_2" amino acids 98 to 149 (52 residues), 57.9 bits, see alignment E=9.5e-20 PF04545: Sigma70_r4" amino acids 102 to 151 (50 residues), 43.7 bits, see alignment E=2.4e-15

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 68% identity to azo:azo2564)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMC4 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Dsui_1302 RNA polymerase sigma factor, sigma-70 family (Dechlorosoma suillum PS)
MEEAPLLAEIPRLRRYARALVGDRAAADDLVQDTLERAWSRRRSWQDDRPLRPWLFSIMH
NLRLDQLRRPGIAPQPLDERIPEPGTRPTQSDALELADLAAALYRLPEEQRAVILLVALE
DMSYDAIAQTLAIPRGTVMSRLFRGREHLRRLMAPESGVTHLRVVP