Protein Info for Dsui_1295 in Dechlorosoma suillum PS

Annotation: lipid A core-O-antigen ligase-like enyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 174 to 189 (16 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details amino acids 219 to 235 (17 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details amino acids 337 to 361 (25 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details amino acids 393 to 410 (18 residues), see Phobius details amino acids 422 to 441 (20 residues), see Phobius details PF15864: PglL_A" amino acids 164 to 188 (25 residues), 26.5 bits, see alignment (E = 7.1e-10) PF04932: Wzy_C" amino acids 202 to 352 (151 residues), 58.9 bits, see alignment E=7.7e-20 PF11846: Wzy_C_2" amino acids 374 to 553 (180 residues), 89.3 bits, see alignment E=5e-29

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMB7 at UniProt or InterPro

Protein Sequence (604 amino acids)

>Dsui_1295 lipid A core-O-antigen ligase-like enyme (Dechlorosoma suillum PS)
MSFSYQRHLQCSLFLVGAMACLPFLNPHHYNPIPSFYAEWWAGLLGLLASSLFLREPARQ
DLRLPLGALIPFALIALFLFQLVAGKVHFLHQGLLFCLYLIWACLMLLLGRVLVREAGLE
RLAQTLSFGFLCGGLMSLLIVGLQLYRPDWLGLEFIFPTRNGQVFANLGQRNQFADYLWL
GVLSAIYLQARQRLRLWQFLLASIPLALCAVFTASRSVYLYIAATAILSFAVGYRQSDFA
SIRRGTGWVIAAALLVELAKHFGNVSDVAMVTAGERLYSDPGGISTRFALWLIAWNSFLQ
APLLGVGLGGFSWQTFALAGSVPPGSLPGAAEHAHNLFAQLLAEFGIASLLTLMLVGVAL
WREFRKQAWGHGHWWGLAAIAIVGLHSQLEYPLWYAFFLGPMAILLGALAPRPISIDLGK
LGPRAMALLLLAGIWVMGNLYRDYSLLEDTMHWRDIDTTQQASWPEVHTRLSKLYGESLF
PHYVQLYYALAAPISPDNLEEKLAITADSLLFSPVDRLVFKYPALLALAGRQDEAQQMLQ
LAILAYPARVPAALRQVRVLADKYPEIRALAASLEKAEAAARQPSGFSAGAAPQTQPSPV
SGNR