Protein Info for Dsui_1210 in Dechlorosoma suillum PS

Annotation: DNA primase, catalytic core

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 TIGR01391: DNA primase" amino acids 1 to 408 (408 residues), 469.5 bits, see alignment E=4.7e-145 PF01807: zf-CHC2" amino acids 3 to 97 (95 residues), 130 bits, see alignment E=1e-41 PF08275: DNAG_N" amino acids 121 to 242 (122 residues), 133.2 bits, see alignment E=2.4e-42 PF13662: Toprim_4" amino acids 250 to 314 (65 residues), 60.7 bits, see alignment E=5.3e-20 PF01751: Toprim" amino acids 251 to 319 (69 residues), 55 bits, see alignment E=3.2e-18 PF13155: Toprim_2" amino acids 253 to 340 (88 residues), 62.5 bits, see alignment E=1.6e-20 PF10410: DnaB_bind" amino acids 360 to 414 (55 residues), 48.7 bits, see alignment 2.8e-16 PF08278: DnaG_DnaB_bind" amino acids 443 to 566 (124 residues), 81.6 bits, see alignment E=2.6e-26

Best Hits

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 67% identity to dar:Daro_0527)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLM0 at UniProt or InterPro

Protein Sequence (584 amino acids)

>Dsui_1210 DNA primase, catalytic core (Dechlorosoma suillum PS)
MIPESFLQELLHRVDIVDLIDGYVPLKKAGANYAACCPFHNEKSPSFTVSPTKQFYHCFG
CGAHGTAIRFLMEYSGLGFIDAVKELAGRMGMVVPEEAGRVRHEGPRTAELTEVMGKAAQ
YYFEQLKHSDKAKEYLKRRGLTGEIALKFRIGYAPEGKYGLKGAFPNYDAPELEKAGLVK
QTEDGRRYDRFRDRVMFPIINQKNEVIAFGGRVIDQGEPKYLNSPETPLFEKGRELFGLP
QARQALREKNTVIVVEGYMDVVALAQHGVGNAVATLGTATTATHVQKLLRQVDRIVYCFD
GDAAGRKAAWRGLENSLESLADNKSIGFVFLPPEHDPDSYVRELGKEAFERMIDQAMPLS
DFLLKELASHCDLTTSEGKSKLVYEAKPLIQRLATPLLRLQLVKRLAEASSFSQQEVERL
CDLKPVARAAPARAPRQALSLPRTLLRLVLHRPDFAARLPLHWLPADSTETRALRRLCEQ
IKRDADLPSSAMLLERLRGGDDEAILQSAAASLLQSPQSEEESEQEFAGALARLEMNWVE
QEFRRLQHKAAGGGLDSEEKREFVHLLQERERLRKAGILAGSGD