Protein Info for Dsui_1182 in Dechlorosoma suillum PS

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR01048: diaminopimelate decarboxylase" amino acids 6 to 414 (409 residues), 527.1 bits, see alignment E=1.2e-162 PF00278: Orn_DAP_Arg_deC" amino acids 30 to 372 (343 residues), 94.4 bits, see alignment E=6.4e-31 PF02784: Orn_Arg_deC_N" amino acids 56 to 283 (228 residues), 225.7 bits, see alignment E=9.1e-71 PF01168: Ala_racemase_N" amino acids 58 to 238 (181 residues), 31.9 bits, see alignment E=1.6e-11

Best Hits

Swiss-Prot: 67% identical to DCDA_PSEFL: Diaminopimelate decarboxylase (lysA) from Pseudomonas fluorescens

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 74% identity to dar:Daro_0207)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKX9 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Dsui_1182 diaminopimelate decarboxylase (Dechlorosoma suillum PS)
MTFFSRKNGVLHAEAVALSSIAAQFGTPTYVYSRAALEAAYGEFRDALAAHPAGAGGLVC
YAVKANSNLGILSLFARLGAGFDIVSGGELERVLAAGAEAGKVVFSGVGKTEAEMARALE
VGIRCFNVESVPELDRLNAVAVRLGKKAPLSLRVNPNVDAKTHPYISTGLKQNKFGVAYE
DALALYRRAASLPGIEVTGIDCHIGSQLLDAAPFAEALDKVLALVDQLAAAGIRLHHIDL
GGGLGIRYLDEAPPRVADYLTPLLQKLEGRGLQVILEPGRRLVGNAGLLLTKIEYLKPGE
EKNFAIVDAAMNDLMRPALYDAYHDIVEVAPGNAAKASYSIVGPICESGDFLGHGRELAV
VPGDLLAVMSAGAYGFSMSSNYNTRPRAAEVMVDGDQVHLVRRRETVAELFALESPLP