Protein Info for Dsui_1181 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 94 to 124 (31 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details PF02518: HATPase_c" amino acids 350 to 459 (110 residues), 65 bits, see alignment E=4e-22

Best Hits

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKX8 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Dsui_1181 signal transduction histidine kinase (Dechlorosoma suillum PS)
MAAMPAATPSLPATPSIASGQPLARLVMLRRIEVLAQGLVLVLAAGWLRIPLEVLPMAAA
SIGLGLFNLYTQWRLGRPRPVGDREYFCQLLPDVLVLTLLLYYAGGSANPFVSLFLLPLT
IAAATLPGRYIWAMAGITLGAYTFLMFFNLPLPPPQGDLARLDEILARASGVAPEHAGHG
GGFALHVLGMWFNFLVSALIVAFFLSRLAATLRERERELGEARQREQERALRHEQILALG
TLAAGAAHKLGTPLSTMAVVLRELELEHGQTPALGEDLALLRQQVDLCKRTLTQVLASAG
AAREGQEAAPARPLGQWLNELLDGWRVLRPRVRVDYQSADGDAEPLVQAEPSLEQALINI
LDNAADASPEGVEVRSRCQGEDCIIEFLDRGPGLDPALAPRLGQAFVSTKDDPTQAGGSG
IGLFLTRATLERFGGRLELCNRPAPEGSGACCRITLPLAALNRHRP