Protein Info for Dsui_1177 in Dechlorosoma suillum PS

Annotation: Ethylbenzene dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF09459: EB_dh" amino acids 25 to 271 (247 residues), 118 bits, see alignment E=3.6e-38

Best Hits

Swiss-Prot: 62% identical to C552_PSEST: Cytochrome c-552 (nirB) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 61% identity to tmz:Tmz1t_2616)

Predicted SEED Role

"Cytochrome c-552 precursor" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKX4 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Dsui_1177 Ethylbenzene dehydrogenase (Dechlorosoma suillum PS)
MFKQTAIASAVGLMLALGSQAAFAAPDWSKVPAKKITVFYPGTSGIEWITKGTDHSGAKG
IRKGEACTGCHEEEIADIGKKVVSGEKLEPNPPKGKAGSIPVNVQAAYDKDNVYFRFSWK
QPASGGEKLDKDNEVKLTVLLAGDKVPLADQVGCWQSCHTDARTMPGADDKKTKYVKDGN
VAGGVYYDLIQWKSGKGAKPVDGYIADKRVMEGGKALVDAKGEKKGDTWTVTFTRKLTGG
EGDVALAEGKTVPFGFAIHDDHAGGRFHHVSFGYSLGVGAKADVTAAKQ