Protein Info for Dsui_1176 in Dechlorosoma suillum PS

Annotation: periplasmic nitrate/nitrite reductase c-type cytochrome, NapC/NirT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details TIGR02161: periplasmic nitrate (or nitrite) reductase c-type cytochrome, NapC/NirT family" amino acids 8 to 188 (181 residues), 313.7 bits, see alignment E=2.1e-98 PF03264: Cytochrom_NNT" amino acids 16 to 188 (173 residues), 266 bits, see alignment E=2.8e-83

Best Hits

Swiss-Prot: 67% identical to NIRT_PSEST: Denitrification system component NirT (nirT) from Pseudomonas stutzeri

KEGG orthology group: K02569, cytochrome c-type protein NapC (inferred from 80% identity to dar:Daro_2579)

MetaCyc: 52% identical to NapC (Aliivibrio fischeri)
RXN-15816 [EC: 7.1.1.8]

Predicted SEED Role

"Cytochrome c-type protein NapC" in subsystem Nitrate and nitrite ammonification or trimethylamine N-oxide (TMAO) reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKX3 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Dsui_1176 periplasmic nitrate/nitrite reductase c-type cytochrome, NapC/NirT family (Dechlorosoma suillum PS)
MSENQKTGLWATLKKPSAKYSLFALITVGFVSGIIFWGGFNTAMEATNTLEFCISCHEMR
DNVYQEYKQTIHYSNRTGVRAVCSDCHVPKDWVHKMKRKIQASQEVWGKLTGTIDTKEKF
EAKRLELATHEWERMKKSDSRECRNCHSFDGMNTDKQKPRAKKMHELAQKDNKTCIDCHK
GIAHHKPQNMPEDDDE