Protein Info for Dsui_1174 in Dechlorosoma suillum PS

Annotation: uncharacterized protein involved in biosynthesis of c-type cytochromes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 110 to 130 (21 residues), see Phobius details PF03918: CcmH" amino acids 15 to 158 (144 residues), 177.2 bits, see alignment E=5.8e-57

Best Hits

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 53% identity to nwa:Nwat_0809)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmL" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKX1 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Dsui_1174 uncharacterized protein involved in biosynthesis of c-type cytochromes (Dechlorosoma suillum PS)
MSPFKRLCLAACLALAALVPFASLQAKEAADLAADPVAEKRLMEISAELRCLVCQNQTIA
DSNADLALDLRREIRGMIQQGKSDREILDFMVARYGDFVLYRPPVQNNTALLWFGPLLIL
VVGLVALVRYLRRRNVAATAAAGGGLSEAERRRAETLLQEAAASDKKDSAQ