Protein Info for Dsui_1173 in Dechlorosoma suillum PS

Annotation: thiol-disulfide isomerase-like thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00578: AhpC-TSA" amino acids 34 to 84 (51 residues), 28.9 bits, see alignment E=9.5e-11 PF08534: Redoxin" amino acids 34 to 85 (52 residues), 39.5 bits, see alignment E=5e-14

Best Hits

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 66% identity to app:CAP2UW1_0722)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKX0 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Dsui_1173 thiol-disulfide isomerase-like thioredoxin (Dechlorosoma suillum PS)
MNKFLWPLIGFIVLVVLLAIGLNLNPREVPSPLVGKPAPAFALPRLDNPAKTFSPEEMKG
QVWLLNVWATWCPSCVQEHPVLVEMSRRNYLPIVGFNWKEVRGDGALDSKPDTPEKEMAL
AIQRSSKLLAAKGNPYQTVIMDLDGRVAIDYGVYGAPETYLIDKAGVIRFKHIGPITPEV
LEKKILPLVAELNK