Protein Info for Dsui_1169 in Dechlorosoma suillum PS

Annotation: heme exporter protein CcmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 17 to 187 (171 residues), 119.2 bits, see alignment E=9.9e-39 TIGR01191: heme exporter protein CcmC" amino acids 48 to 229 (182 residues), 230.3 bits, see alignment E=8.1e-73

Best Hits

Swiss-Prot: 48% identical to CCMC_PSEAE: Heme exporter protein C (ccmC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02195, heme exporter protein C (inferred from 85% identity to app:CAP2UW1_0726)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKW6 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Dsui_1169 heme exporter protein CcmC (Dechlorosoma suillum PS)
MNNRLINWFKFASPATFYPLAGKMIPWFVALSVVFGVAGLYLGMFVAPTDFQQGEGYRII
FIHVPASWMSMFIYLVMAFWAALGLAFNTRLSGMMATALAPTGALMAFLSLWTGALWGKP
MWGTWWVWDARLTSELILLFLYIGFIALQSAIDDPRRADKAGAVLALVGVVNIPIIYFSV
KWWNTLHQGASVSLTKSPSMAATMLWAMLLVALCFWMYSIAVALGRARNIMLERERHTEW
VRQLLAGKES