Protein Info for Dsui_1163 in Dechlorosoma suillum PS

Annotation: hydrogenase accessory protein HypB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR00073: hydrogenase accessory protein HypB" amino acids 159 to 368 (210 residues), 297.3 bits, see alignment E=3e-93 PF02492: cobW" amino acids 190 to 349 (160 residues), 85.6 bits, see alignment E=1.6e-28

Best Hits

KEGG orthology group: K04652, hydrogenase nickel incorporation protein HypB (inferred from 52% identity to ddc:Dd586_2726)

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation-associated protein HypB" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKW0 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Dsui_1163 hydrogenase accessory protein HypB (Dechlorosoma suillum PS)
MCTTCGCGAGETRIEGDALHDHEHGHEHWHVHEDGTAHSHGHEHGHGHSHAHDEHQHEHV
HADGTRHSHPHHHDGEHHHDHQGVTPQPAAPAHGHVHTHADGTSHSHPHTHEGEHHHAHA
EGDQGDHGHGHHHHHGDGSIDYGSGPAGAHAPGMSQKRMVQIERDILSKNDAYAAKNRQA
LAEKGVFALNLVSSPGSGKTTLLCRSIEELKAKYRVAVIEGDQQTSFDAERIRATGAPAL
QINTGKGCHLDAHMVGHALEKLEVQDDSLLLIENVGNLVCPAAFDLGEAGKVVILSVTEG
EDKPLKYPDMFRAARLMLLSKVDLLPHLTFDADKAVEYARRVNPALEVIRVSTTSGEGFA
EWLAWVEKGLAAAKAARQENVAALKARIAELEGLLARR