Protein Info for Dsui_1156 in Dechlorosoma suillum PS

Annotation: putative divalent heavy-metal cations transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 205 to 230 (26 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details PF02535: Zip" amino acids 154 to 295 (142 residues), 60.2 bits, see alignment E=1e-20

Best Hits

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 42% identity to pfv:Psefu_2276)

Predicted SEED Role

"Metal transporter, ZIP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKV3 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Dsui_1156 putative divalent heavy-metal cations transporter (Dechlorosoma suillum PS)
MSAFIHQLDDHVLHSRHPWRRGAGLAIAVAGTVILAAHGVAALLDALESSGMTGALLGGM
AGAAATAAGAVAMLFLGKLNGRREDQLMAFAAGVMLAAAIVSLFIPAIEAAAPVFGNASP
LAVLLALGAGVGLMLGLDKALPHAHAVSGVHGPATHASRGLLLALALFLHNFPEGMAVGI
AASGGAGAVVPVALAIAVQDVPEGLLVALALGAAGMNLQRAVLLGAATGLAEPVGAWIAA
TVLGDNPALYPVGLAFAAGAMGFVVFHEMLPELKSRGGLPQVSGALAGGIALMLGVDLFL
G