Protein Info for Dsui_1137 in Dechlorosoma suillum PS

Annotation: chromate transporter, chromate ion transporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 157 to 189 (33 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 339 to 364 (26 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details amino acids 413 to 430 (18 residues), see Phobius details amino acids 436 to 453 (18 residues), see Phobius details PF02417: Chromate_transp" amino acids 23 to 188 (166 residues), 154.7 bits, see alignment E=1.2e-49 amino acids 263 to 448 (186 residues), 122.4 bits, see alignment E=1e-39 TIGR00937: chromate efflux transporter" amino acids 30 to 447 (418 residues), 222.1 bits, see alignment E=8.8e-70

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 84% identity to dar:Daro_3555)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKT4 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Dsui_1137 chromate transporter, chromate ion transporter family (Dechlorosoma suillum PS)
MSTILTAADSTSPESKPAEVSFWQAFLFWLKLGFISFGGPAGQIAIMHQELVERRRWISE
RRFLHALNYCMVLPGPEAQQLATYIGWLMHRTWGGIVAGGLFVLPSLFILIGLSWIYIAF
GNVPLVAGLFYGIKPAVTAIVVQAAHRIGSRALKNNALWAIAAASFVAIFALNVPFPAIV
AAAAAIGYFGGRVAPDKFKAGGGHGKADKSFGRALIDDDTPTPVHARFSWGQLAKVALIG
GLLWLVPMGLLTASYGWSHTLTQMGWFFTKAALLTFGGAYAVLPYVYQGAVGSYGWLTGP
QMIDGLALGETTPGPLIMVVTFVGFVGGYVKAVFGPDSLFLAGAVAAMLVTWFTFLPSFV
FILMGGPFIETTHNDLKFTAPLTAITAAVVGVILNLALFFGYHVLWPKGFDGAFEWVSAL
IALGAAIALFRFKANVIHVIGGCAVIGFLVKMFL