Protein Info for Dsui_1129 in Dechlorosoma suillum PS

Annotation: acetyl/propionyl-CoA carboxylase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF16576: HlyD_D23" amino acids 167 to 218 (52 residues), 30.1 bits, see alignment 4.4e-11 amino acids 220 to 325 (106 residues), 59.2 bits, see alignment E=5.4e-20 PF13533: Biotin_lipoyl_2" amino acids 185 to 217 (33 residues), 32.6 bits, see alignment (E = 8e-12) PF13437: HlyD_3" amino acids 226 to 322 (97 residues), 41.9 bits, see alignment E=2.2e-14

Best Hits

KEGG orthology group: None (inferred from 68% identity to sml:Smlt0037)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKS6 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Dsui_1129 acetyl/propionyl-CoA carboxylase, alpha subunit (Dechlorosoma suillum PS)
MNRLLPLILVPLLLTACGNDTPPSAVVAAEKASAAEEYERGPHRGRMLRQGDFALEVTIY
ETNVPPQYRLYAYQNGKPLPPASVQAAIQLKRLDGEFNNFTFTPEKDYLNGSSEVIEPHS
FDVEVKAQHAGQSYSWAFPSYEGRTTIPAAAANDAGVKVEKAGPTTIRNTVRLMGAVMVD
ANRRAEIKARFPGIVRAVNVQEGQRVSRGQTLVAIEGNDSMRTYSVVAPFDGIVLARNTN
VGDVAGSNTLVELADLSSVWVELRALGGDAEKLSVGQEVEISSATGGSRVTGKIQTLLPL
ASGQSVVARASIANPEGRWRPGMAVSADVTVAARQVPLAVKESGLQRFRDFTVVFTQVGD
TYEVRMLELGERDGRYAEVLGGLKQGATYVAEQSFLIKADIEKSGASHDH