Protein Info for Dsui_1111 in Dechlorosoma suillum PS

Annotation: ABC-type branched-chain amino acid transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 268 to 297 (30 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 330 (280 residues), 123.6 bits, see alignment E=4.2e-40

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 79% identity to azo:azo3444)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QK80 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Dsui_1111 ABC-type branched-chain amino acid transport system, permease component (Dechlorosoma suillum PS)
MLYREAGQFKTSYAADQQIFPIRQDRIAIGLILVVAALVVPMVASEYWIKAILIPFLIFS
LAALGLNILTGYAGQLSLGSAAFMAVGAFAAYNFMGRIEGMPVLLAFVGGGLSAAAVGIL
FGLPSLRIKGFYLAVATLAAQFFIVWALTKFGWFSMDSSSGVITAQEIQILGYRFDTPIS
LYLLVLTIVAVMALAAKNMVRSSVGRAWMAVRDMDVAAEVIGIRIMHTKLLAFAISSFYC
GVAGALYAYAYLGTVEPEGFNLDLSFKILFMIIIGGVGSIMGSFLGAAFIVLLPIFLDVL
IQDFLTGLLPPSISSNLQLMVFGGLIIFFLIVEPHGLARLWQIGKEKLRLWPFPH