Protein Info for Dsui_1110 in Dechlorosoma suillum PS

Annotation: branched-chain amino acid ABC-type transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 59 to 82 (24 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 226 to 250 (25 residues), see Phobius details amino acids 260 to 283 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 268 (261 residues), 98.5 bits, see alignment E=1.9e-32

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 79% identity to azo:azo3445)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QK79 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Dsui_1110 branched-chain amino acid ABC-type transport system, permease component (Dechlorosoma suillum PS)
MQFFFEVLIGGLLSGVMYSFVALGFVMIYKASGVFNFAQGAMVFFAALTFVGFQEMGAPF
WLALILAFGAMVLLGIATERIVLRPLVNQPHITLFMATIGLTFFVEGLAQGIWGSTVRGL
DLGIQDEPIEWIMDKAGILVSSFDLFAAGVAAALVTLLALFFQYTRVGRALRAVADDHQA
ALSIGIPLQNIWRIVWAVAGFVALVAGLLWGARNGVQFALTFTALKALPVLILGGFTSVP
GAIVGGLIIGSTEKLAEVYLGGYVGGGIDSWFPYVMALAFLLIRPEGLFGEKHIDRV