Protein Info for Dsui_1106 in Dechlorosoma suillum PS

Annotation: nitroreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00881: Nitroreductase
  • amino acids 13 to 205 (193 residues), 133 bits, E=1.2e-42

Best Hits

KEGG orthology group: None (inferred from 68% identity to bug:BC1001_4704)

MetaCyc: 45% identical to 4-nitrobenzoate reductase (Pseudomonas putida TW3)
1.7.1.-

Predicted SEED Role

"Oxygen-insensitive NADPH nitroreductase (EC 1.-.-.-)" (EC 1.-.-.-)

MetaCyc Pathways

• 4-nitrobenzoate degradation (1/2 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

See G8QK75 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Dsui_1106 nitroreductase (Dechlorosoma suillum PS)
MTTDRQRLVDETIDSRRSVRAFLPTPVPRETLEEILRISSRAPSGTNVQPWKVYVLTGNA
KDQLSQKILAAYNDPEEAQTHTEEYPYYPAKWVSPYIDRRRKVGLDLYGLLDIKKGDAAR
MHAQHGRNYTFFDAPVGLIFTIDRIMQQGSWFDYGMFVQTIMLAARARGLDTCPQAAFTQ
FHRIIGEQLNLPENEMVVCGMALGYADESKPENKLRTERAPLEEWVRFCD