Protein Info for Dsui_1097 in Dechlorosoma suillum PS

Annotation: NADH/NADPH-dependent glutamate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01317: glutamate synthase, NADH/NADPH, small subunit
  • amino acids 3 to 487 (485 residues), 739.2 bits, E=1.1e-226
• PF14691: Fer4_20
  • amino acids 24 to 131 (108 residues), 92.5 bits, E=1.1e-29
• PF07992: Pyr_redox_2
  • amino acids 144 to 469 (326 residues), 98.6 bits, E=3.3e-31
• PF00070: Pyr_redox
  • amino acids 145 to 179 (35 residues), 27.8 bits, 2e-09
• PF01266: DAO
  • amino acids 145 to 179 (35 residues), 34.5 bits, 1.2e-11
• PF01494: FAD_binding_3
  • amino acids 145 to 177 (33 residues), 28.5 bits, see alignment (E = 6.5e-10)
• PF12831: FAD_oxidored
  • amino acids 146 to 182 (37 residues), 33.4 bits, 2.3e-11
• PF00890: FAD_binding_2
  • amino acids 146 to 180 (35 residues), 28 bits, 9.4e-10
• PF13450: NAD_binding_8
  • amino acids 148 to 183 (36 residues), 45.5 bits, 5.2e-15
• PF01593: Amino_oxidase
  • amino acids 154 to 183 (30 residues), 38.6 bits, see alignment (E = 6.2e-13)

Best Hits

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 83% identity to tmz:Tmz1t_0843)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of ammonia assimilation (plants) (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• L-glutamate biosynthesis IV (1/1 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Sequence Analysis Tools

See G8QK66 at UniProt or InterPro

Protein Sequence (488 amino acids)

>Dsui_1097 NADH/NADPH-dependent glutamate synthase small subunit (Dechlorosoma suillum PS)
MGKPTGFMEFQRLSEAYEPVEARLKHYKEFVGHLSDADAKTQGARCMDCGIPFCNNGCPV
NNIIPDWNDLVYRGNWEEAIAVLHSTNNFPEFTGRICPAPCEAACTLGINEAPVGIKSIE
HAIIDKAWENGWVKPQPAKVKTGKKVAIVGGGPAGLAAAQQLARAGHDVTVFEKNDRVGG
LLRYGIPDFKLEKGLIDRRMEQMQAEGVTFRTKTIVGTKTLPAGIVNDATTVVSAEQLSK
EFDAVVLTGGSEVPRDLPVPGRELKGVHYALEFLIPQNKEVAGDGKNPIRADGKHVVVIG
GGDTGSDCVGTSNRHGAASITQFEVMPKPPVEENKALTWPYWPLKLRTSSSHDEGCTRDF
AVSTKELIGDGNGNVKALKAVRVEWKDGKMVEVAGSEFEIPADLVLLAMGFTNPVAGLLE
AFGVDKDARGNAKATTDGAGCYATNVPKVFAAGDVRRGQSLVVWAIREGRQAAREVDAFL
TGASELPR