Protein Info for Dsui_1043 in Dechlorosoma suillum PS

Annotation: quinolinate synthetase complex, A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00550: quinolinate synthetase complex, A subunit
  • amino acids 17 to 365 (349 residues), 300.8 bits, E=5.6e-94
• PF02445: NadA
  • amino acids 21 to 362 (342 residues), 325.9 bits, E=1.1e-101

Best Hits

Swiss-Prot: 56% identical to NADA_HERA2: Quinolinate synthase A (nadA) from Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 83% identity to azo:azo0741)

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (6/6 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

See G8QJM0 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Dsui_1043 quinolinate synthetase complex, A subunit (Dechlorosoma suillum PS)
MQATIQFDRFNQMADADCQERIRAARAKLGKKAVLLCHHYQRADVYQHADLTGDSLKLSR
LASQTDAEYIVFCGVHFMAEVADIMSKPEQIAILPDLAAGCSMADMANLAKVERCWRELN
EVLGNAESLVTPVTYINSAADLKAFCGERGGIVCTSSNAGTIAKWAFAQREKVLFFPDQH
LGRWTGHNMDIPMEQMVVWDPDQEYGGLTPQQIKEAKILLWKGHCSVHQMFQPAHIQRFR
QEHPDGLVISHPECCFDVCKASDYVGSTEHIVKTIKEAAPNTRWLVGTELNLVNRLAEEV
KAEGKIVQFMAPTVCMCSTMQRIDPQHLAWTLENLAEGNVVNRISVPAHEAPMAKLALDR
MLAIS