Protein Info for Dsui_1041 in Dechlorosoma suillum PS

Annotation: phosphatidylserine/phosphatidylglycerophosphate/ cardiolipin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 364 to 384 (21 residues), see Phobius details PF13091: PLDc_2" amino acids 24 to 132 (109 residues), 51.7 bits, see alignment E=8e-18 amino acids 216 to 341 (126 residues), 96.5 bits, see alignment E=1.1e-31 PF00614: PLDc" amino acids 111 to 133 (23 residues), 28.4 bits, see alignment (E = 1.2e-10)

Best Hits

KEGG orthology group: K06132, putative cardiolipin synthase [EC: 2.7.8.-] (inferred from 67% identity to app:CAP2UW1_0295)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJL8 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Dsui_1041 phosphatidylserine/phosphatidylglycerophosphate/ cardiolipin synthase (Dechlorosoma suillum PS)
MDAAYLPGNRVTLLNSGDEFFPALLAAIDGAEREVHLETYIFEADETGQAVASALCRAAR
RGLKVRVLADGFGARDFPRTLMPALVADGVQVLIYRPELPDLGLRRHRLRRLHRKITVVD
GRLAFVGGINIIDDRNTPHQIPPRFDYAVCVEGPLLEPIQRSVRHVWEIVVWASFRHRFR
LPPPAPACCQPVGNQTAAFVVRDNIRHRRDIEDAYLQAIASAREEVILANAYFLPGRRFK
EALREAAARGVRVTILLQGRVEYRLLHYASQALYGSLLEAGIRIVEYHRSFLHAKVAVVD
RDWATVGSSNIDPFSLLLAREANVVVRDATFTAQLRSSLQQAMAEGGRELLPGRWRRIPW
HSRWLRRLAYSLVRLMIGLAGYGARH