Protein Info for Dsui_1036 in Dechlorosoma suillum PS

Annotation: ribose-phosphate pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF13793: Pribosyltran_N" amino acids 6 to 124 (119 residues), 164.3 bits, see alignment E=1.4e-52 TIGR01251: ribose-phosphate diphosphokinase" amino acids 7 to 315 (309 residues), 407.4 bits, see alignment E=1.5e-126 PF00156: Pribosyltran" amino acids 156 to 263 (108 residues), 73.8 bits, see alignment E=1.6e-24 PF14572: Pribosyl_synth" amino acids 206 to 315 (110 residues), 105 bits, see alignment E=7.4e-34

Best Hits

Swiss-Prot: 75% identical to KPRS_NITEU: Ribose-phosphate pyrophosphokinase (prs) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 87% identity to dar:Daro_3730)

MetaCyc: 65% identical to ribose-phosphate diphosphokinase (Escherichia coli K-12 substr. MG1655)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJL3 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Dsui_1036 ribose-phosphate pyrophosphokinase (Dechlorosoma suillum PS)
MAFNSLMVFTGNANPKLAADVVSRLGRRPLGRASVGRFSDGEVSVEIEEHVRGHDVFILQ
STCAPSNDTLMELLVMVDALKRASAGRITAAIPYFGYARQDRRSRSSRVPIAAKLVADLL
TAAGVDRVLTMDLHAEQIQGFFDIPVDNVYALPILLEDIQKQNHENLLVVSPDHGGVVRA
RSLAKRLECDLAIIDKRRPKANVSEVMNIIGEVDGRTCIIMDDIVDTAGTLCKAASALKA
NGAQKVVAYCTHPVLSGAAVERVNSSDLDELVVTDTIPLRDDAMACSRIRQLSVAELLAE
TIRRISNEDSVSSLFIE