Protein Info for Dsui_1028 in Dechlorosoma suillum PS

Annotation: pantetheine-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 73% identical to COAD_AROAE: Phosphopantetheine adenylyltransferase (coaD) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 78% identity to dar:Daro_3723)

MetaCyc: 58% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]

Predicted SEED Role

"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
coenzyme A biosynthesis I (bacteria) (4/4 steps found)
coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
coenzyme A biosynthesis III (archaea) (3/4 steps found)

KEGG Metabolic Maps

Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJK6 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Dsui_1028 pantetheine-phosphate adenylyltransferase (Dechlorosoma suillum PS)
MLNNRLAIYPGTFDPLTKGHEDLVRRASSLFDRVIVAVADSPNKRPFFGLEDRVAMAQEI
LAPYGNVEVKGFSCLLMDFLHQQGAKVIIRGLRAVSDFEYEFQMAGMNRNLYPEVETVFL
TPGEQYMFISATMVREIARLGGDVSKFVQPVVEKRLAAKKVSELS