Protein Info for Dsui_1012 in Dechlorosoma suillum PS

Annotation: ABC-type branched-chain amino acid transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 53 (53 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 53 to 405 (353 residues), 159.3 bits, see alignment E=3.1e-50 PF13433: Peripla_BP_5" amino acids 54 to 253 (200 residues), 34.6 bits, see alignment E=1.8e-12 PF01094: ANF_receptor" amino acids 84 to 248 (165 residues), 66 bits, see alignment E=4.8e-22

Best Hits

KEGG orthology group: None (inferred from 78% identity to dar:Daro_0524)

Predicted SEED Role

"Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJJ1 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Dsui_1012 ABC-type branched-chain amino acid transport system, periplasmic component (Dechlorosoma suillum PS)
MAGGRLRHRYNRSCHPIFPDLPAMKARRPAPCRRLPAALLAALSLIAGPALAQVRIGVIA
SSTGVTAQVGIPQKNSVALLPAEIGGQKVEYFVLDDASDPTNAVTAVKKLIGEHKVDALI
GPTTSPAALAMLDFVAEAKTPLVTTVGSSAIVQPMDEKKMWVFKTTQNDDLIAEAVIAHM
QASGVRSVGFIGFNDPYGENWHKVFAALAEKAGIRLVASERFVRTDQSVIGQALKLISAK
PDAIFIAATGGPAVLPQATLLEKGYKGRLYQTHGVATNDFIKLGGKAVEGTLMAGGPLLV
ADGLKDGNPIKAVAQGYIRAYEGRYGAGTMSTFGANTYDAGLLLQKAIPLALKKGHPGTA
EFRTALRDALEQSKEVVGAQGVFNMTPANHNGMDQRARLMMTVQNGRWVPLH