Protein Info for Dsui_0998 in Dechlorosoma suillum PS

Annotation: A/G-specific adenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 TIGR01084: A/G-specific adenine glycosylase" amino acids 12 to 277 (266 residues), 328 bits, see alignment E=2.7e-102 PF00730: HhH-GPD" amino acids 42 to 174 (133 residues), 75.9 bits, see alignment E=3e-25 PF14815: NUDIX_4" amino acids 242 to 349 (108 residues), 78 bits, see alignment E=4.7e-26

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 60% identity to dar:Daro_0064)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJH8 at UniProt or InterPro

Protein Sequence (353 amino acids)

>Dsui_0998 A/G-specific adenine glycosylase (Dechlorosoma suillum PS)
MPKTAPDPVAEFAPRLIAWQKRHGRHDLPWQQTRDAYPIWLSEIMLQQTQVTTVMPYYAR
FLAEFPTLADLAAAPVERVLELWAGLGYYARARNLHACAVRVMAEHGGRFPREPERIAEL
PGIGRSTAAAIAAFAYGVRAAILDGNVKRVLCRCFGVSGFPGSPKVEKGLWQLAESLLPH
GTGEIEIYTQGIMDLGASLCSRGKPTCAICPMQEICVARREGRQEELPEARPGKVIPERR
VTAVIFSDGPRLLLQRRPPSGIWGGLLALPELAPGESAASLALGLGLQLQAEQALPPIRH
TFTHFRLELTPLLCQVAPVATAGEPGWEWLPWQDMATAALPTPLRKLLQAPLF