Protein Info for Dsui_0995 in Dechlorosoma suillum PS

Annotation: arabinose efflux permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 306 to 332 (27 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 359 (342 residues), 110.3 bits, see alignment E=5.1e-36

Best Hits

KEGG orthology group: None (inferred from 62% identity to app:CAP2UW1_4052)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJH5 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Dsui_0995 arabinose efflux permease family protein (Dechlorosoma suillum PS)
MTVPAAFPWRLVLLCCGAEILTMLGFALVPTLLPTFTAEWGLSATEGGWLGGVFFLGYIT
AVPLLVSLTDRYDARRIYLLAASLSALALAAFALFARGFVPGLLCWLVAGFGLAGTYMPG
LRALTDRLPVAFQSRGTAFYTASFGTGAGLSYLLLEGLGRLLPWPLLFALAAAAVAAAVA
LIAFALPPKLPATAAGSGDGGWRSVLRDRRILAFCGAYCGHNWELFGFRSWLVAYLTWSH
LQTPSALTAAPGIVAALATFLAVPASILGNEGAHRWGRTVWLRRVMNLSAAMALLVALMG
NVGGHGWWAMVLLLAYAATMNLDSAAMTAGLLTETPPDRRGKALALYACIGFAGGFVGPV
AFGMALDAFGRHGVGGWSAGFVTLALGIGLARLSIGLVDKKGPAAT