Protein Info for Dsui_0992 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07456: Hpre_diP_synt_I
  • amino acids 28 to 173 (146 residues), 133.3 bits, E=3.6e-43

Best Hits

KEGG orthology group: K00805, heptaprenyl diphosphate synthase [EC: 2.5.1.30] (inferred from 73% identity to app:CAP2UW1_4050)

Predicted SEED Role

"Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)" in subsystem Polyprenyl Diphosphate Biosynthesis or Sex pheromones in Enterococcus faecalis and other Firmicutes (EC 2.5.1.30)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (10/12 steps found)
• superpathway of menaquinol-7 biosynthesis (8/10 steps found)
• taxadiene biosynthesis (engineered) (10/13 steps found)
• geranylgeranyl diphosphate biosynthesis (1/1 steps found)
• heptaprenyl diphosphate biosynthesis (1/1 steps found)
• ophiobolin F biosynthesis (2/3 steps found)
• methyl phomopsenoate biosynthesis (2/4 steps found)
• plaunotol biosynthesis (1/3 steps found)
• stellatic acid biosynthesis (4/8 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
• paspaline biosynthesis (1/6 steps found)
• brassicicene C biosynthesis (1/7 steps found)
• fusicoccin A biosynthesis (1/8 steps found)
• superpathway of phylloquinol biosynthesis (6/15 steps found)
• C_25,25 CDP-archaeol biosynthesis (1/10 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.30

Sequence Analysis Tools

See G8QJH2 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Dsui_0992 putative membrane protein (Dechlorosoma suillum PS)
MTPSATDADCRRVLRIPLSAEDHRIARLAAAAIGLSLIDAAIPTPLPGVKPGLANIVTLI
VLARCGWRAAAWVTGLRVLAGSLLLGQFLAPGFFLSATGALFSLLALGAARHLPGRWFGP
VSLSVIAAFAHMAGQILLARAWLIPHDGVFLLAPLFACAALFFGTVNGLIAARFLSTPLA
AEAAAAESAHV