Protein Info for Dsui_0989 in Dechlorosoma suillum PS

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 TIGR01891: amidohydrolase" amino acids 12 to 372 (361 residues), 379.5 bits, see alignment E=8.9e-118 PF01546: Peptidase_M20" amino acids 71 to 381 (311 residues), 177.2 bits, see alignment E=4.2e-56 PF07687: M20_dimer" amino acids 180 to 275 (96 residues), 43.1 bits, see alignment E=3.7e-15

Best Hits

Swiss-Prot: 40% identical to ILL3_ORYSJ: IAA-amino acid hydrolase ILR1-like 3 (ILL3) from Oryza sativa subsp. japonica

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 81% identity to dar:Daro_0071)

MetaCyc: 51% identical to beta-tabtoxin peptidase (Pseudomonas syringae)
3.4.11.-

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJG9 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Dsui_0989 amidohydrolase (Dechlorosoma suillum PS)
MHLLSIPFLPELTALRRDIHAHPELAFDESRTADIVARELERYGIEVHRGIARTGVVGVL
RNGSSKRAIGLRADMDALPLEEKNEFPHRSRHEGKMHACGHDGHTALLLGAARWLAEQRN
FDGTVVFIFQPAEESEGGAAVMIEDGLFEKFPVDAVYGLHNWPGIPLGEMAIMPGPVMAG
TCAFEIAIRGHGCHAAMPHQGVDPIVAGSQLVQALQTVVSRTLHPCESAVVSVTQFHAGS
AWNIIPDDAILRGTIRTFKPEVQETVERAIERLVSGVAAATGAQIGVTFDHRYPPTVNSG
PETEVCRHAARAVLGHERVITDALPSMGAEDFAYMLREKPGCYVWLGNGPGTGGCTLHNP
HYDFNDEALAVGISYWVSLAETALKPV