Protein Info for Dsui_0984 in Dechlorosoma suillum PS

Annotation: isopropylmalate/homocitrate/citramalate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF00682: HMGL-like" amino acids 7 to 279 (273 residues), 207.5 bits, see alignment E=1.3e-65

Best Hits

Swiss-Prot: 68% identical to HMGCL_BOVIN: Hydroxymethylglutaryl-CoA lyase, mitochondrial (HMGCL) from Bos taurus

KEGG orthology group: K01640, hydroxymethylglutaryl-CoA lyase [EC: 4.1.3.4] (inferred from 76% identity to dar:Daro_0086)

MetaCyc: 66% identical to Hydroxymethylglutaryl-CoA lyase, mitochondrial (Homo sapiens)
Hydroxymethylglutaryl-CoA lyase. [EC: 4.1.3.4]

Predicted SEED Role

"Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 4.1.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ21 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Dsui_0984 isopropylmalate/homocitrate/citramalate synthase (Dechlorosoma suillum PS)
MPLPTHVKIVEVGPRDGLQNEKQVVPTAVKIELIERLAAAGLPAVEATSFVSPKWVPQMG
DNSEVLRGIRQQPGVAYPVLTPNLKGFDSAVEAGATEVAIFGAASEAFSQKNINCSIAES
LKRFEPIVSAASALEIKVRGYVSCVVGCPYEGAVAPEKAAEVAKILYDMGCYEVSLGDTI
GVGNPASVSRLLEACARHVPMAKLAGHYHDTYGMAVANIYASLQLGLAVFDASVAGLGGC
PYAKGASGNVATEDVVYLLEGLGISTGIDLQRLVEAGAFISAHLGRESASKAARALLAKC
AG