Protein Info for Dsui_0983 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 766 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 132 to 149 (18 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 211 to 306 (96 residues), 31.6 bits, see alignment E=1.5e-11 PF13188: PAS_8" amino acids 215 to 254 (40 residues), 25.7 bits, see alignment 1.2e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 331 to 478 (148 residues), 46.9 bits, see alignment E=2.4e-16 PF00990: GGDEF" amino acids 331 to 480 (150 residues), 70.1 bits, see alignment E=2.9e-23 PF00563: EAL" amino acids 508 to 738 (231 residues), 248.5 bits, see alignment E=9e-78

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ20 at UniProt or InterPro

Protein Sequence (766 amino acids)

>Dsui_0983 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MLKKLARLFLLHEPEAPELGEPVWRQSALRIILISGICLEFLVAAHSSWQAIGLGLYHIP
VIVTGFYLLLAAAIYAALRNVRLGAGFLLLTIYAASLHILFFVDVFEIAKLGIIFAYSAP
LVARLFFGMRSAVLMMLLNTLLFAVLLRNQPLLNPLGPQYSITLPESHAYIQTLVFLFFN
LCVPLAVFRALQALEFRGVQLAVSNQRLSRSNSVFRDMFDHSGMALLICGRGGHIIKANT
QAAQLLGVSSEQLEEGQNMQRYLGIWGRKPEELGGERQVRRPDGQLRWVTVQPRRLEHDG
NFLVILRDDTPLREAKLALARSAANASYLELHDTLTGLPNRQYLRQRFEELGQAGEERAW
ALLNLRLTNLRAVNDRLGPAIGDALLRAYGQALAEHLPADAFLARTAGVTFALLLPLEPG
EAPEARARGLLQQLPRELALPDSGLAVPVPVAVGVTAARLDEGADEALQRVQTALELARN
LPEGSVAVLDQEMEQRHHRQLDLELALRELDDSGLELVYQPKCLADGKVLGFEALLRWQH
PRLGAVSPAEFIPLAERTGLMHRLTDFVLEQVCRQLQRWQGEGCRLLPVAINLSALDIVR
PDIVHRLGETLARHHIPPALVEIEITETGLIRDERLAVENAQALRERGFALLIDDFGTGY
SSLSKLNEFPVSAIKIDRSFIADLPGQEKKALIVKSILSLSRVLGCATVAEGVETREQLD
FLTALGCTAYQGYYFHRPLPATTAGGLLERQPGPAPGEALMSPLPA