Protein Info for Dsui_0970 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 TIGR00229: PAS domain S-box protein" amino acids 10 to 132 (123 residues), 82.2 bits, see alignment E=3.3e-27 amino acids 135 to 264 (130 residues), 31.8 bits, see alignment E=1.3e-11 PF13188: PAS_8" amino acids 11 to 65 (55 residues), 35.1 bits, see alignment 2.6e-12 PF00989: PAS" amino acids 12 to 122 (111 residues), 65.6 bits, see alignment E=1.2e-21 PF08448: PAS_4" amino acids 17 to 127 (111 residues), 44.4 bits, see alignment E=5.2e-15 amino acids 154 to 258 (105 residues), 23.2 bits, see alignment E=2e-08 PF13426: PAS_9" amino acids 21 to 122 (102 residues), 53.5 bits, see alignment E=7.5e-18 PF08447: PAS_3" amino acids 32 to 118 (87 residues), 42.3 bits, see alignment E=2.3e-14 amino acids 164 to 249 (86 residues), 43.5 bits, see alignment E=9.3e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 265 to 427 (163 residues), 157.1 bits, see alignment E=3.4e-50 PF00990: GGDEF" amino acids 268 to 425 (158 residues), 141.6 bits, see alignment E=6.1e-45

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ07 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Dsui_0970 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MKKRIADDTSLLQAIYDSSSVGIFLLDMSGRIVHANRRMADLFHYTLDELVGSEYVSLIH
PQEREAGRQNMLNTMARGVGHVDVERLYRRRDGSEFWGNLTGKALVDANGRTTGLVGNIA
DIDQRKRTEWELAASQERFERLARTVPCVLYDYILHGDGDSRFLYLNSRCEEIFEVPAEV
LMANMECFWQLVHPEDLPRLRQEEQAANRSASQFSSEIRILTPSGRQKWLRLSSRPNVIE
PGQSAVWSGFMLDITQAKQLEDELRQLATTDALTGLCNRQSFLRLADQEMARFNRAGNPA
SVLMLDLDYFKHINDTYGHGVGDAVLRDFSRRTGILLRQVDLFGRIGGEEFCILSPDTDQ
DGGLALGQRLCQTIAGQPAHCNGLTIAYTVSIGVTGFRAGDPNFDAVLARADSALYQAKR
HGRNQVAQM