Protein Info for Dsui_0965 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details PF02308: MgtC" amino acids 13 to 142 (130 residues), 130.6 bits, see alignment E=2.1e-42

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 70% identity to mag:amb2756)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ02 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Dsui_0965 putative membrane protein (Dechlorosoma suillum PS)
MSNDYLEIILHLGSAWVAGSLVGLERSFHGRPAGFRTHALVCLASALLMVVTTYQGRWMT
AMPLEAIRTDPTRMAQGIMTGIGFLGAGVIFKEGLTVRGLTTAASIWITAALGILYGIGF
YFPALISTAAVLGTLALFRWIEYRVPSQAYAHLVLRYPGSGAPVEDTVRQLLQGFGFSIA
NMSYRLSESGAVYEYRMIIKTYGKHNFERLAEHLRQGNGLLEFRISPTGD