Protein Info for Dsui_0961 in Dechlorosoma suillum PS

Annotation: RNA polymerase sigma factor, SigZ family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 12 to 160 (149 residues), 69.9 bits, see alignment E=2.1e-23 TIGR02959: RNA polymerase sigma factor, SigZ family" amino acids 14 to 180 (167 residues), 179.7 bits, see alignment E=4.3e-57 PF04542: Sigma70_r2" amino acids 15 to 79 (65 residues), 48.1 bits, see alignment E=1.6e-16 PF08281: Sigma70_r4_2" amino acids 104 to 156 (53 residues), 47.6 bits, see alignment E=2e-16 PF04545: Sigma70_r4" amino acids 109 to 158 (50 residues), 32.7 bits, see alignment E=8.4e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 63% identity to dar:Daro_2950)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIZ8 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Dsui_0961 RNA polymerase sigma factor, SigZ family (Dechlorosoma suillum PS)
MPRMNPMKCVDAAWKAHEAELMRFIAARLPDREEARDLLQEVFLRALRQPDALCGVENPR
AWLFQVARNLLIDRFRLQRQQLPLDEDWPAAEIPEVPPVDRLADCLPRVLGELAEADREA
IRLCDIEGLSQQEFAQRQGLSLAAAKSRVQRARRRLRARLVQACQVRFDGEGQVCCFVPR
PPLLPRD