Protein Info for Dsui_0960 in Dechlorosoma suillum PS

Annotation: putative permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details PF03773: ArsP_1" amino acids 55 to 348 (294 residues), 247.4 bits, see alignment E=8.8e-78

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 79% identity to dar:Daro_2949)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIZ7 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Dsui_0960 putative permease (Dechlorosoma suillum PS)
MNVEMNTAAPARGLGWRWLCGTAAAAGLWFWLYGNLTAIADFVVAALGQSRQTALGEALH
FFVYDTPKVLLLLTGIVFLMGVVQTFFAPERTRALLSGRRTGVGNVLAAGLGIVTPFCSC
SAVPFFIGFLSAGVPLGVTFSFLIAAPMINEVALALLFGMFGWQVALLYLGLGLLVAILA
GLVIGHLKMEAHLEDWVRAIQAGAPASFTGGGMSWVQRGRAGLDHVRDIVAKVWPYVVAG
IALGAGIHGYVPEDFMASFMGKDVWWAVPAAVVLGVPMYTNAAGIIPVVEALIGKGAALG
TVLAFMMSVIALSAPEMIILRKALKPRLIATFAGVVALGILLVGYVFNAVL