Protein Info for Dsui_0954 in Dechlorosoma suillum PS

Annotation: Dinitrogenase reductase ADP-ribosyltransferase (DRAT)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to DRAT_RHORU: NAD(+)--dinitrogen-reductase ADP-D-ribosyltransferase (draT) from Rhodospirillum rubrum

KEGG orthology group: K05951, NAD+---dinitrogen-reductase ADP-D-ribosyltransferase [EC: 2.4.2.37] (inferred from 62% identity to mag:amb1575)

Predicted SEED Role

"NAD(+)--dinitrogen-reductase ADP-D-ribosyltransferase (EC 2.4.2.37)" (EC 2.4.2.37)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIZ1 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Dsui_0954 Dinitrogenase reductase ADP-ribosyltransferase (DRAT) (Dechlorosoma suillum PS)
MKPDLPTVPLAPPPPGHSTNLVGVPSGLLASPAFNEHPLRLHISGVRETSPALFRMLEDS
TCAEEAMDAFQKYMAAVFGVNEGPERRPRDDGTARPGPRLFRSSYRRLLQGWGFDANNPE
GAVLKGWVESRFGLLPTFHKEPLGRYPSRAWMTYVEEKMCARFHNNSIQLQLDLLYEYCQ
WMLARYIFPSRRHLTLYRGVNDLSEHHVVSTLSRREAIVRQNNLISFTDDREVADQFGDT
ILEVQVPLVKILFFNGLLPGPVLKGEGEYLVIGGDYRVQMSYY