Protein Info for Dsui_0940 in Dechlorosoma suillum PS

Annotation: Nif-specific regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 TIGR01817: Nif-specific regulatory protein" amino acids 12 to 577 (566 residues), 693.3 bits, see alignment E=1.2e-212 PF13185: GAF_2" amino acids 29 to 169 (141 residues), 51.3 bits, see alignment E=5.8e-17 PF01590: GAF" amino acids 31 to 169 (139 residues), 50.1 bits, see alignment E=1.6e-16 PF00158: Sigma54_activat" amino acids 203 to 369 (167 residues), 245.5 bits, see alignment E=9.2e-77 PF14532: Sigma54_activ_2" amino acids 204 to 374 (171 residues), 71.6 bits, see alignment E=3.3e-23 PF07728: AAA_5" amino acids 227 to 347 (121 residues), 34.1 bits, see alignment E=1.1e-11 PF00004: AAA" amino acids 227 to 345 (119 residues), 22.5 bits, see alignment E=5.4e-08 PF02954: HTH_8" amino acids 534 to 570 (37 residues), 48.4 bits, see alignment 2.5e-16

Best Hits

KEGG orthology group: K02584, Nif-specific regulatory protein (inferred from 53% identity to pna:Pnap_1570)

Predicted SEED Role

"Nitrogenase (molybdenum-iron)-specific transcriptional regulator NifA" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIX7 at UniProt or InterPro

Protein Sequence (577 amino acids)

>Dsui_0940 Nif-specific regulatory protein (Dechlorosoma suillum PS)
MTATKLDRDADLELVTIYEISKILTSSLDFQKSVREALNVMLTHLHMRHAMVSMVQGEGK
LHVLGAAGVPFAVQEDIILDAESGIVGQVLKHGSPMVVPDITADPVFINRTGRDLSQCAG
VALIAVPVKIGREVVGVLSVDRPPGASKPASFDRDVRLLSLVASLVGQTFKLHQAIAAER
AQLMLETHRLQKQLQGKYDVENVIGRSKRMKEVFADVHQAAPGNSTILLRGESGTGKEAI
AHAIHYLSPRSKGPFVKVNCAALPETLLESELFGHEKGAFTGATAERKGRFEMADGGTLF
LDEIGDISSSFQAKLLRVLQEHEFERVGGNKTHKANFRLVAATNRNLEEMVQKGDFRADL
YFRLNVVAILLPPLRERKEDIPLLVDFFLSRFNRENNRKLTITPGAVEILQHCNWPGNVR
ELENCIERAATMTRGALIRESDMRCQKGQCFSSVLLESSASRACHPVMDMPGTHPGGHTT
FPAREPIQPQSQPVHFRDPIPVVAAPARPAMPAAAPPDYGDDDLAEGSDAFVSERERLIE
AMERCGWVQAKAARLLNLTPRQIGYALKKFNIEVKRL