Protein Info for Dsui_0930 in Dechlorosoma suillum PS

Annotation: transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF08448: PAS_4" amino acids 15 to 130 (116 residues), 50.7 bits, see alignment E=7.7e-17 PF00158: Sigma54_activat" amino acids 139 to 306 (168 residues), 229.8 bits, see alignment E=6.2e-72 PF14532: Sigma54_activ_2" amino acids 140 to 310 (171 residues), 65 bits, see alignment E=3.6e-21 PF07728: AAA_5" amino acids 163 to 282 (120 residues), 38.8 bits, see alignment E=3.7e-13 PF00004: AAA" amino acids 163 to 297 (135 residues), 25.4 bits, see alignment E=6.7e-09 PF25601: AAA_lid_14" amino acids 312 to 386 (75 residues), 69 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: None (inferred from 74% identity to dar:Daro_0682)

Predicted SEED Role

"sigma54 specific transcriptional regulator, Fis family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIW8 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Dsui_0930 transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains (Dechlorosoma suillum PS)
MDYSASQLNELISFLDGLPEPRIVMDADYRIVAANKAYRREYAGSGSGGVASILGRRCYE
VSHHFTVPCDQAGESCPLKLSQEEGASRRVLHLHHTPRGEEHVDVETTPVRDQEGRIVYF
VETLRMVQQASSRPAAQGLVGRSPAFQQMLEKVLRVAPAQATVLLLGETGTGKELVAQAV
HEASGRRDSPFVAVDCTGLTENLFESELFGHEKGAFTGAAFRKLGLVESASGGTLFLDEI
GELPPALQVKLLRLLETGTYRRVGGVDTLRADFRLVAATHRDLKEMVRQERFRRDLYYRL
NTFPIHTPSLAERREDIPLLAASLLERVDHRPGRHFSAEALAWLAGRNWEGNIRELRNLI
ERATLMSDGEEISAAKLAEVADDGGESKALAEGVGGGADDSFRVPGPLPLAQLEQRYLAW
LMARPGADVRTLAPALGVSERTLYRKLRR